Lineage for d2afaa1 (2afa A:4-415)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645795Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 645796Superfamily a.102.1: Six-hairpin glycosidases [48208] (7 families) (S)
  5. 645897Family a.102.1.3: N-acylglucosamine (NAG) epimerase [48222] (2 proteins)
  6. 645902Protein Putative NAG isomerase YihS [140788] (1 species)
  7. 645903Species Salmonella typhimurium [TaxId:90371] [140789] (1 PDB entry)
  8. 645904Domain d2afaa1: 2afa A:4-415 [126668]

Details for d2afaa1

PDB Entry: 2afa (more details), 2.15 Å

PDB Description: Crystal Structure of putative NAG isomerase from Salmonella typhimurium
PDB Compounds: (A:) NAG isomerase

SCOP Domain Sequences for d2afaa1:

Sequence, based on SEQRES records: (download)

>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 602]}
kwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvys
vaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallgaa
savttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhaveaf
livydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfra
yggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvys
vdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsww
qeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldina

Sequence, based on observed residues (ATOM records): (download)

>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 602]}
kwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvys
vaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallgaa
savttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhaveaf
livydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfra
yggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvys
vdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsww
qeldadnkvttgkqdiyhllhclviprlplapglapavaaglldina

SCOP Domain Coordinates for d2afaa1:

Click to download the PDB-style file with coordinates for d2afaa1.
(The format of our PDB-style files is described here.)

Timeline for d2afaa1: