Lineage for d2afaa1 (2afa A:4-415)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004180Family a.102.1.3: N-acylglucosamine (NAG) epimerase [48222] (2 protein domains)
    automatically mapped to Pfam PF07221
  6. 2004185Protein Putative NAG isomerase YihS [140788] (2 species)
  7. 2004193Species Salmonella typhimurium [TaxId:90371] [140789] (2 PDB entries)
    Uniprot Q8ZKT7 2-413
  8. 2004200Domain d2afaa1: 2afa A:4-415 [126668]
    Other proteins in same PDB: d2afaa2, d2afab3, d2afac3, d2afad3, d2afae3, d2afaf3

Details for d2afaa1

PDB Entry: 2afa (more details), 2.15 Å

PDB Description: Crystal Structure of putative NAG isomerase from Salmonella typhimurium
PDB Compounds: (A:) NAG isomerase

SCOPe Domain Sequences for d2afaa1:

Sequence, based on SEQRES records: (download)

>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]}
kwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvys
vaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallgaa
savttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhaveaf
livydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfra
yggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvys
vdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsww
qeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldina

Sequence, based on observed residues (ATOM records): (download)

>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]}
kwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvys
vaasmgrpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallgaa
savttghpearklldytieviekyfwseeeqmcleswdeafsqtedyrggnanmhaveaf
livydvthdkkwldralriasviihdvarngdyrvnehfdsqwnpirdynkdnpahrfra
yggtpghwiewgrlmlhlhaalearfetppawlledakglfhatirdawapdgadgfvys
vdwdgkpivrervrwpiveamgtayalytltddsqyeewyqkwwdycikylmdyengsww
qeldadnkvttgkqdiyhllhclviprlplapglapavaaglldina

SCOPe Domain Coordinates for d2afaa1:

Click to download the PDB-style file with coordinates for d2afaa1.
(The format of our PDB-style files is described here.)

Timeline for d2afaa1: