SCOPe 2.08: Domain d2af7g_: 2af7 G:

Lineage for d2af7g_ (2af7 G:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.2: CMD-like [101468] (2 proteins)
   Pfam PF02627; hexamer of single-domain subunits

6. Protein Gamma-carboxymuconolactone decarboxylase, CMD [140968] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [140969] (1 PDB entry)
   Uniprot O26336 1-119

8. Domain d2af7g_: 2af7 G: [126664]
   automated match to d2af7a1

Details for d2af7g_

PDB Entry: 2af7, 2.81 Å

PDB Description: Crystal structure of the gamma-carboxymuconolactone decarboxylase from Methanobacterium thermoautotrophicum. Northeast Structural Genomics Consortium target TT747.

PDB Compounds: (G:) gamma-carboxymuconolactone decarboxylase

SCOPe Domain Sequences for d2af7g_:

Sequence; same for both SEQRES and ATOM records:

>d2af7g_ a.152.1.2 (G:) Gamma-carboxymuconolactone decarboxylase, CMD {Methanobacterium thermoautotrophicum [TaxId: 145262]}
eryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrelltl
aaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevfte

Timeline for d2af7g_:

• d2af7g_ first appeared in SCOP 1.73, called d2af7g1
  
• d2af7g_ appears in SCOPe 2.07