Lineage for d2af7f1 (2af7 F:2-119)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650162Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 650163Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 650188Family a.152.1.2: CMD-like [101468] (2 proteins)
    Pfam PF02627; hexamer of single-domain subunits
  6. 650189Protein Gamma-carboxymuconolactone decarboxylase, CMD [140968] (1 species)
  7. 650190Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [140969] (1 PDB entry)
  8. 650196Domain d2af7f1: 2af7 F:2-119 [126663]
    automatically matched to 2AF7 A:1-119

Details for d2af7f1

PDB Entry: 2af7 (more details), 2.81 Å

PDB Description: Crystal structure of the gamma-carboxymuconolactone decarboxylase from Methanobacterium thermoautotrophicum. Northeast Structural Genomics Consortium target TT747.
PDB Compounds: (F:) gamma-carboxymuconolactone decarboxylase

SCOP Domain Sequences for d2af7f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2af7f1 a.152.1.2 (F:2-119) Gamma-carboxymuconolactone decarboxylase, CMD {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
eryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrelltl
aaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevfte

SCOP Domain Coordinates for d2af7f1:

Click to download the PDB-style file with coordinates for d2af7f1.
(The format of our PDB-style files is described here.)

Timeline for d2af7f1: