![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
![]() | Superfamily a.152.1: AhpD-like [69118] (4 families) ![]() probable biological unit contains six domains of this fold arranged with 32 symmetry |
![]() | Family a.152.1.2: CMD-like [101468] (2 proteins) Pfam PF02627; hexamer of single-domain subunits |
![]() | Protein Gamma-carboxymuconolactone decarboxylase, CMD [140968] (1 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [140969] (1 PDB entry) Uniprot O26336 1-119 |
![]() | Domain d2af7c_: 2af7 C: [126660] automated match to d2af7a1 |
PDB Entry: 2af7 (more details), 2.81 Å
SCOPe Domain Sequences for d2af7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2af7c_ a.152.1.2 (C:) Gamma-carboxymuconolactone decarboxylase, CMD {Methanobacterium thermoautotrophicum [TaxId: 145262]} eryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrelltl aaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevfte
Timeline for d2af7c_: