Lineage for d2af7a1 (2af7 A:1-119)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017477Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2017478Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2017508Family a.152.1.2: CMD-like [101468] (2 proteins)
    Pfam PF02627; hexamer of single-domain subunits
  6. 2017509Protein Gamma-carboxymuconolactone decarboxylase, CMD [140968] (1 species)
  7. 2017510Species Methanobacterium thermoautotrophicum [TaxId:145262] [140969] (1 PDB entry)
    Uniprot O26336 1-119
  8. 2017511Domain d2af7a1: 2af7 A:1-119 [126658]

Details for d2af7a1

PDB Entry: 2af7 (more details), 2.81 Å

PDB Description: Crystal structure of the gamma-carboxymuconolactone decarboxylase from Methanobacterium thermoautotrophicum. Northeast Structural Genomics Consortium target TT747.
PDB Compounds: (A:) gamma-carboxymuconolactone decarboxylase

SCOPe Domain Sequences for d2af7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2af7a1 a.152.1.2 (A:1-119) Gamma-carboxymuconolactone decarboxylase, CMD {Methanobacterium thermoautotrophicum [TaxId: 145262]}
meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevfte

SCOPe Domain Coordinates for d2af7a1:

Click to download the PDB-style file with coordinates for d2af7a1.
(The format of our PDB-style files is described here.)

Timeline for d2af7a1: