Lineage for d2af3d_ (2af3 D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1005388Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1005389Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1005588Family c.77.1.5: Phosphotransacetylase [102663] (2 proteins)
    Pfam PF01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families
  6. 1005592Protein Phosphotransacetylase Pta [110717] (3 species)
  7. 1005606Species Methanosarcina thermophila [TaxId:2210] [110718] (3 PDB entries)
    Uniprot P38503
  8. 1005610Domain d2af3d_: 2af3 D: [126655]
    automated match to d1qzta_
    complexed with coa, so4

Details for d2af3d_

PDB Entry: 2af3 (more details), 2.6 Å

PDB Description: phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a
PDB Compounds: (D:) Phosphate acetyltransferase

SCOPe Domain Sequences for d2af3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2af3d_ c.77.1.5 (D:) Phosphotransacetylase Pta {Methanosarcina thermophila [TaxId: 2210]}
vtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdld
lskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgvv
sgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsve
dvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaidg
elqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqgl
akpindlsrgcsdedivgavaitcvqaaaqdk

SCOPe Domain Coordinates for d2af3d_:

Click to download the PDB-style file with coordinates for d2af3d_.
(The format of our PDB-style files is described here.)

Timeline for d2af3d_: