Lineage for d2af3d1 (2af3 D:2-333)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708456Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 708457Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) (S)
    the constituent families form similar dimers
  5. 708589Family c.77.1.5: Phosphotransacetylase [102663] (2 proteins)
    Pfam PF01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families
  6. 708593Protein Phosphotransacetylase Pta [110717] (3 species)
  7. 708607Species Methanosarcina thermophila [TaxId:2210] [110718] (3 PDB entries)
  8. 708615Domain d2af3d1: 2af3 D:2-333 [126655]
    automatically matched to d1qzta_
    complexed with coa, so4

Details for d2af3d1

PDB Entry: 2af3 (more details), 2.6 Å

PDB Description: phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a
PDB Compounds: (D:) Phosphate acetyltransferase

SCOP Domain Sequences for d2af3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2af3d1 c.77.1.5 (D:2-333) Phosphotransacetylase Pta {Methanosarcina thermophila [TaxId: 2210]}
vtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdld
lskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgvv
sgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsve
dvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaidg
elqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqgl
akpindlsrgcsdedivgavaitcvqaaaqdk

SCOP Domain Coordinates for d2af3d1:

Click to download the PDB-style file with coordinates for d2af3d1.
(The format of our PDB-style files is described here.)

Timeline for d2af3d1: