![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.5: Phosphotransacetylase [102663] (3 proteins) Pfam PF01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families |
![]() | Protein Phosphotransacetylase Pta [110717] (3 species) |
![]() | Species Methanosarcina thermophila [TaxId:2210] [110718] (3 PDB entries) Uniprot P38503 |
![]() | Domain d2af3d_: 2af3 D: [126655] automated match to d1qzta_ complexed with coa, so4 |
PDB Entry: 2af3 (more details), 2.6 Å
SCOPe Domain Sequences for d2af3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2af3d_ c.77.1.5 (D:) Phosphotransacetylase Pta {Methanosarcina thermophila [TaxId: 2210]} vtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdld lskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgvv sgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsve dvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaidg elqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqgl akpindlsrgcsdedivgavaitcvqaaaqdk
Timeline for d2af3d_: