Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) |
Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species) |
Species Human (Homo sapiens) [TaxId:9606] [49333] (27 PDB entries) |
Domain d2af2a1: 2af2 A:1-153 [126652] automatically matched to d1l3na_ complexed with zn; mutant |
PDB Entry: 2af2 (more details)
SCOP Domain Sequences for d2af2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2af2a1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh ekaddlgkggneestktgnagsrlacgvigiaq
Timeline for d2af2a1: