Lineage for d2aewb1 (2aew B:32-129)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787437Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 787438Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
    Pfam PF00041
  6. 787661Protein Growth hormone receptor [49280] (1 species)
  7. 787662Species Human (Homo sapiens) [TaxId:9606] [49281] (7 PDB entries)
    tandem of fibronectin type III domains
  8. 787677Domain d2aewb1: 2aew B:32-129 [126650]
    automatically matched to d1hwgb1

Details for d2aewb1

PDB Entry: 2aew (more details), 2.7 Å

PDB Description: a model for growth hormone receptor activation based on subunit rotation within a receptor dimer
PDB Compounds: (B:) growth hormone receptor

SCOP Domain Sequences for d2aewb1:

Sequence, based on SEQRES records: (download)

>d2aewb1 b.1.2.1 (B:32-129) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
epkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsage
nscyfnssftsiwipycikltsnggtvdekcfsvdeiv

Sequence, based on observed residues (ATOM records): (download)

>d2aewb1 b.1.2.1 (B:32-129) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
epkftkcrsperetfschwtdapiqlfytraaawkecpdyvsagenscyfnssftsiwip
ycikltsnggtvdekcfsvdeiv

SCOP Domain Coordinates for d2aewb1:

Click to download the PDB-style file with coordinates for d2aewb1.
(The format of our PDB-style files is described here.)

Timeline for d2aewb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aewb2