SCOP 1.73: Domain d2aewb1: 2aew B:32-129

Lineage for d2aewb1 (2aew B:32-129)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Growth hormone receptor [49280] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49281] (7 PDB entries)
   tandem of fibronectin type III domains

8. Domain d2aewb1: 2aew B:32-129 [126650]
   automatically matched to d1hwgb1

Details for d2aewb1

PDB Entry: 2aew, 2.7 Å

PDB Description: a model for growth hormone receptor activation based on subunit rotation within a receptor dimer

PDB Compounds: (B:) growth hormone receptor

SCOP Domain Sequences for d2aewb1:

Sequence, based on SEQRES records:

>d2aewb1 b.1.2.1 (B:32-129) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
epkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsage
nscyfnssftsiwipycikltsnggtvdekcfsvdeiv

Sequence, based on observed residues (ATOM records):

>d2aewb1 b.1.2.1 (B:32-129) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
epkftkcrsperetfschwtdapiqlfytraaawkecpdyvsagenscyfnssftsiwip
ycikltsnggtvdekcfsvdeiv

Timeline for d2aewb1:

• d2aewb1 is new in SCOP 1.73
  
• d2aewb1 appears in SCOP 1.75
  
• d2aewb1 appears in the current release, SCOPe 2.08