![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (43 proteins) Pfam PF00041 |
![]() | Protein Growth hormone receptor [49280] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49281] (7 PDB entries) tandem of fibronectin type III domains |
![]() | Domain d2aewb1: 2aew B:32-129 [126650] automatically matched to d1hwgb1 |
PDB Entry: 2aew (more details), 2.7 Å
SCOP Domain Sequences for d2aewb1:
Sequence, based on SEQRES records: (download)
>d2aewb1 b.1.2.1 (B:32-129) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} epkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsage nscyfnssftsiwipycikltsnggtvdekcfsvdeiv
>d2aewb1 b.1.2.1 (B:32-129) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} epkftkcrsperetfschwtdapiqlfytraaawkecpdyvsagenscyfnssftsiwip ycikltsnggtvdekcfsvdeiv
Timeline for d2aewb1: