Lineage for d2aerl2 (2aer L:87-142)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031664Protein automated matches [190092] (2 species)
    not a true protein
  7. 3031665Species Human (Homo sapiens) [TaxId:9606] [187310] (69 PDB entries)
  8. 3031691Domain d2aerl2: 2aer L:87-142 [126642]
    Other proteins in same PDB: d2aerh_, d2aerl1, d2aerl3, d2aert1, d2aert2, d2aert3
    automated match to d2a2ql2
    complexed with ben, ca, cl, fuc, glc, mg, na, zn

Details for d2aerl2

PDB Entry: 2aer (more details), 1.87 Å

PDB Description: crystal structure of benzamidine-factor viia/soluble tissue factor complex.
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2aerl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aerl2 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d2aerl2:

Click to download the PDB-style file with coordinates for d2aerl2.
(The format of our PDB-style files is described here.)

Timeline for d2aerl2: