Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225423] (29 PDB entries) |
Domain d2aerl1: 2aer L:49-86 [126641] Other proteins in same PDB: d2aerh_, d2aerl2, d2aerl3, d2aert1, d2aert2, d2aert3 automated match to d2a2ql1 complexed with ben, ca, cl, fuc, glc, mg, na, zn |
PDB Entry: 2aer (more details), 1.87 Å
SCOPe Domain Sequences for d2aerl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aerl1 g.3.11.0 (L:49-86) automated matches {Human (Homo sapiens) [TaxId: 9606]} qcasspcqnggsckdqlqsyicfclpafegrncethkd
Timeline for d2aerl1:
View in 3D Domains from other chains: (mouse over for more information) d2aerh_, d2aert1, d2aert2, d2aert3 |