Lineage for d2aerl1 (2aer L:49-86)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258773Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2258774Protein automated matches [226968] (4 species)
    not a true protein
  7. 2258775Species Human (Homo sapiens) [TaxId:9606] [225423] (29 PDB entries)
  8. 2258777Domain d2aerl1: 2aer L:49-86 [126641]
    Other proteins in same PDB: d2aerh_, d2aerl2, d2aerl3, d2aert1, d2aert2, d2aert3
    automated match to d2a2ql1
    complexed with ben, ca, cl, fuc, glc, mg, na, zn

Details for d2aerl1

PDB Entry: 2aer (more details), 1.87 Å

PDB Description: crystal structure of benzamidine-factor viia/soluble tissue factor complex.
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2aerl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aerl1 g.3.11.0 (L:49-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d2aerl1:

Click to download the PDB-style file with coordinates for d2aerl1.
(The format of our PDB-style files is described here.)

Timeline for d2aerl1: