Lineage for d2aerl1 (2aer L:46-82)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747785Protein Factor IX (IXa) [57198] (2 species)
  7. 747791Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)
  8. 747796Domain d2aerl1: 2aer L:46-82 [126641]
    Other proteins in same PDB: d2aerh1, d2aerl3, d2aert1, d2aert2
    automatically matched to d1pfxl1
    complexed with ben, ca, cl, fuc, glc, mg, na, zn

Details for d2aerl1

PDB Entry: 2aer (more details), 1.87 Å

PDB Description: crystal structure of benzamidine-factor viia/soluble tissue factor complex.
PDB Compounds: (L:) Coagulation factor VII

SCOP Domain Sequences for d2aerl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aerl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce

SCOP Domain Coordinates for d2aerl1:

Click to download the PDB-style file with coordinates for d2aerl1.
(The format of our PDB-style files is described here.)

Timeline for d2aerl1: