Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries) |
Domain d2aerh_: 2aer H: [126640] Other proteins in same PDB: d2aerl1, d2aerl2, d2aerl3, d2aert1, d2aert2, d2aert3 automated match to d1cvwh_ complexed with ben, ca, cl, fuc, glc, mg, na, zn |
PDB Entry: 2aer (more details), 1.87 Å
SCOPe Domain Sequences for d2aerh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aerh_ b.47.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d2aerh_: