| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (1 family) ![]() |
| Family a.11.2.1: Second domain of FERM [47032] (8 proteins) |
| Protein Focal adhesion kinase 1 [140380] (1 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [140381] (3 PDB entries) Uniprot Q00944 131-253 |
| Domain d2aehb1: 2aeh B:131-253 [126628] Other proteins in same PDB: d2aeha2, d2aeha3, d2aehb2, d2aehb3 automatically matched to 2AL6 A:131-253 |
PDB Entry: 2aeh (more details), 2.53 Å
SCOP Domain Sequences for d2aehb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aehb1 a.11.2.1 (B:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsygemrgnalek
ksnyevlekdvglrrffpkslldsvkaktlrkliqqtfrqfanlnreesilkffeilspv
yrf
Timeline for d2aehb1: