Lineage for d2aeha2 (2aeh A:254-363)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2413059Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 2413069Protein Focal adhesion kinase 1 [141432] (1 species)
  7. 2413070Species Chicken (Gallus gallus) [TaxId:9031] [141433] (2 PDB entries)
    Uniprot Q00944 254-363
  8. 2413073Domain d2aeha2: 2aeh A:254-363 [126626]
    Other proteins in same PDB: d2aeha1, d2aeha3, d2aehb1, d2aehb3
    automated match to d2al6a2

Details for d2aeha2

PDB Entry: 2aeh (more details), 2.53 Å

PDB Description: Focal adhesion kinase 1
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2aeha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aeha2 b.55.1.5 (A:254-363) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk
gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfiirpq

SCOPe Domain Coordinates for d2aeha2:

Click to download the PDB-style file with coordinates for d2aeha2.
(The format of our PDB-style files is described here.)

Timeline for d2aeha2: