Lineage for d2aegb1 (2aeg B:2-244)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1053174Fold d.303: BB1717-like [143080] (1 superfamily)
    complex fold with a bifurcated beta-sheet structure surrounded by helices; contains beta-sheet barrel, closed (n=5, S=8)
  4. 1053175Superfamily d.303.1: BB1717-like [143081] (2 families) (S)
  5. 1053176Family d.303.1.1: BB1717-like [143082] (4 proteins)
    Pfam PF02586; DUF159, COG2135
  6. 1053177Protein Hypothetical protein Atu5096 [143083] (1 species)
  7. 1053178Species Agrobacterium tumefaciens [TaxId:358] [143084] (1 PDB entry)
    Uniprot Q8UKK6 2-244
  8. 1053180Domain d2aegb1: 2aeg B:2-244 [126623]
    automatically matched to 2AEG A:2-244

Details for d2aegb1

PDB Entry: 2aeg (more details), 2.3 Å

PDB Description: X-Ray Crystal Structure of Protein Atu5096 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR63.
PDB Compounds: (B:) hypothetical protein AGR_pAT_140

SCOPe Domain Sequences for d2aegb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aegb1 d.303.1.1 (B:2-244) Hypothetical protein Atu5096 {Agrobacterium tumefaciens [TaxId: 358]}
cnlyrmedkdwvskwaqdaeslinlmpayqmnpdqmgpivrntadgkkqlvharwglpsp
ifvqkkaaearadklkakgkafdinelirmepdrgvtnvrklnlphwtrwfgvehrclvp
vtsfaepdpaskqeggnvpnawfardeakslmffagihvpqwksvrkvrdglttddlygf
lttdpndlvkpihekampvllltreeteiwmrapwdeakhlarplpndaliilsrepygs
siv

SCOPe Domain Coordinates for d2aegb1:

Click to download the PDB-style file with coordinates for d2aegb1.
(The format of our PDB-style files is described here.)

Timeline for d2aegb1: