Lineage for d2aegb_ (2aeg B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010404Fold d.303: BB1717-like [143080] (1 superfamily)
    complex fold with a bifurcated beta-sheet structure surrounded by helices; contains beta-sheet barrel, closed (n=5, S=8)
  4. 3010405Superfamily d.303.1: BB1717-like [143081] (2 families) (S)
  5. 3010406Family d.303.1.1: BB1717-like [143082] (4 proteins)
    Pfam PF02586; DUF159, COG2135
  6. 3010407Protein Hypothetical protein Atu5096 [143083] (1 species)
  7. 3010408Species Agrobacterium tumefaciens [TaxId:358] [143084] (1 PDB entry)
    Uniprot Q8UKK6 2-244
  8. 3010410Domain d2aegb_: 2aeg B: [126623]
    automated match to d2aega1

Details for d2aegb_

PDB Entry: 2aeg (more details), 2.3 Å

PDB Description: X-Ray Crystal Structure of Protein Atu5096 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR63.
PDB Compounds: (B:) hypothetical protein AGR_pAT_140

SCOPe Domain Sequences for d2aegb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aegb_ d.303.1.1 (B:) Hypothetical protein Atu5096 {Agrobacterium tumefaciens [TaxId: 358]}
cnlyrmedkdwvskwaqdaeslinlmpayqmnpdqmgpivrntadgkkqlvharwglpsp
ifvqkkaaearadklkakgkafdinelirmepdrgvtnvrklnlphwtrwfgvehrclvp
vtsfaepdpaskqeggnvpnawfardeakslmffagihvpqwksvrkvrdglttddlygf
lttdpndlvkpihekampvllltreeteiwmrapwdeakhlarplpndaliilsrepygs
siv

SCOPe Domain Coordinates for d2aegb_:

Click to download the PDB-style file with coordinates for d2aegb_.
(The format of our PDB-style files is described here.)

Timeline for d2aegb_: