Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Orotate PRTase [53290] (3 species) |
Species Streptococcus pyogenes [TaxId:1314] [142553] (1 PDB entry) Uniprot Q9A076 1-208 |
Domain d2aeeb_: 2aee B: [126621] Other proteins in same PDB: d2aeea2 automated match to d2aeea1 complexed with cl, gol, so4 |
PDB Entry: 2aee (more details), 1.95 Å
SCOPe Domain Sequences for d2aeeb_:
Sequence, based on SEQRES records: (download)
>d2aeeb_ c.61.1.1 (B:) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfveti kahfpeveviagtatagiphgaiiadkmtlpfayirskpkdhgagnqiegrvlkgqkmvi iedlistggsvldaaaaasregadvlgvvaiftyelpkasqnfkeagiklitlsnyteli avaklqgyitndglhllkkfkedqvnwqq
>d2aeeb_ c.61.1.1 (B:) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfveti kahfpeveviagtatagiphgaiiadkmtlpfayirskpnqiegrvlkgqkmviiedlis tggsvldaaaaasregadvlgvvaiftyelpkasqnfkeagiklitlsnyteliavaklq gyitndglhllkkfkedqvnwqq
Timeline for d2aeeb_: