SCOP 1.75: Domain d2aeeb1: 2aee B:1-208

Lineage for d2aeeb1 (2aee B:1-208)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)

6. Protein Orotate PRTase [53290] (3 species)

7. Species Streptococcus pyogenes [TaxId:1314] [142553] (1 PDB entry)
   Uniprot Q9A076 1-208

8. Domain d2aeeb1: 2aee B:1-208 [126621]
   automatically matched to 2AEE A:1-208
   complexed with cl, gol, so4

Details for d2aeeb1

PDB Entry: 2aee, 1.95 Å

PDB Description: Crystal structure of Orotate phosphoribosyltransferase from Streptococcus pyogenes

PDB Compounds: (B:) orotate phosphoribosyltransferase

SCOP Domain Sequences for d2aeeb1:

Sequence, based on SEQRES records:

>d2aeeb1 c.61.1.1 (B:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]}
mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfveti
kahfpeveviagtatagiphgaiiadkmtlpfayirskpkdhgagnqiegrvlkgqkmvi
iedlistggsvldaaaaasregadvlgvvaiftyelpkasqnfkeagiklitlsnyteli
avaklqgyitndglhllkkfkedqvnwq

Sequence, based on observed residues (ATOM records):

>d2aeeb1 c.61.1.1 (B:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]}
mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfveti
kahfpeveviagtatagiphgaiiadkmtlpfayirskpnqiegrvlkgqkmviiedlis
tggsvldaaaaasregadvlgvvaiftyelpkasqnfkeagiklitlsnyteliavaklq
gyitndglhllkkfkedqvnwq

Timeline for d2aeeb1:

• d2aeeb1 first appeared in SCOP 1.73
  
• d2aeeb1 is called d2aeeb_ in SCOPe 2.01
  
• d2aeeb1 appears in the current release, SCOPe 2.08, called d2aeeb_