Lineage for d2aeea1 (2aee A:1-208)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128442Protein Orotate PRTase [53290] (3 species)
  7. 2128451Species Streptococcus pyogenes [TaxId:1314] [142553] (1 PDB entry)
    Uniprot Q9A076 1-208
  8. 2128452Domain d2aeea1: 2aee A:1-208 [126620]
    Other proteins in same PDB: d2aeea2
    complexed with cl, gol, so4

Details for d2aeea1

PDB Entry: 2aee (more details), 1.95 Å

PDB Description: Crystal structure of Orotate phosphoribosyltransferase from Streptococcus pyogenes
PDB Compounds: (A:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d2aeea1:

Sequence, based on SEQRES records: (download)

>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]}
mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfveti
kahfpeveviagtatagiphgaiiadkmtlpfayirskpkdhgagnqiegrvlkgqkmvi
iedlistggsvldaaaaasregadvlgvvaiftyelpkasqnfkeagiklitlsnyteli
avaklqgyitndglhllkkfkedqvnwq

Sequence, based on observed residues (ATOM records): (download)

>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]}
mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfveti
kahfpeveviagtatagiphgaiiadkmtlpfayirskpkgnqiegrvlkgqkmviiedl
istggsvldaaaaasregadvlgvvaiftyelpkasqnfkeagiklitlsnyteliavak
lqgyitndglhllkkfkedqvnwq

SCOPe Domain Coordinates for d2aeea1:

Click to download the PDB-style file with coordinates for d2aeea1.
(The format of our PDB-style files is described here.)

Timeline for d2aeea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aeea2
View in 3D
Domains from other chains:
(mouse over for more information)
d2aeeb_