Lineage for d2aebb_ (2aeb B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481831Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2481832Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2481833Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2482113Protein automated matches [190112] (5 species)
    not a true protein
  7. 2482128Species Human (Homo sapiens) [TaxId:9606] [186835] (13 PDB entries)
  8. 2482130Domain d2aebb_: 2aeb B: [126618]
    automated match to d1hqfa_
    complexed with abh, mn

Details for d2aebb_

PDB Entry: 2aeb (more details), 1.29 Å

PDB Description: crystal structure of human arginase i at 1.29 a resolution and exploration of inhibition in immune response.
PDB Compounds: (B:) arginase 1

SCOPe Domain Sequences for d2aebb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aebb_ c.42.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
glaregnhk

SCOPe Domain Coordinates for d2aebb_:

Click to download the PDB-style file with coordinates for d2aebb_.
(The format of our PDB-style files is described here.)

Timeline for d2aebb_: