SCOPe 2.08: Domain d2aeba_: 2aeb A:

Lineage for d2aeba_ (2aeb A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
   Pfam PF00491

6. Protein automated matches [190112] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186835] (13 PDB entries)

8. Domain d2aeba_: 2aeb A: [126617]
   automated match to d1hqfa_
   complexed with abh, mn

Details for d2aeba_

PDB Entry: 2aeb, 1.29 Å

PDB Description: crystal structure of human arginase i at 1.29 a resolution and exploration of inhibition in immune response.

PDB Compounds: (A:) arginase 1

SCOPe Domain Sequences for d2aeba_:

Sequence; same for both SEQRES and ATOM records:

>d2aeba_ c.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
glaregnhkpidyl

Timeline for d2aeba_:

• d2aeba_ first appeared in SCOP 1.73, called d2aeba1
  
• d2aeba_ appears in SCOPe 2.07