SCOPe 2.03: Domain d2ae9a1: 2ae9 A:1-76

Lineage for d2ae9a1 (2ae9 A:1-76)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family)
   automatically mapped to Pfam PF06440

5. Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
   Pfam PF06440
   independent solution structure determinations of different members resulted in similar secondary structures but different folds

6. Protein Theta subunit of DNA polymerase III [46577] (1 species)

7. Species Escherichia coli [TaxId:562] [46578] (3 PDB entries)

8. Domain d2ae9a1: 2ae9 A:1-76 [126616]
   automatically matched to d1du2a_

Details for d2ae9a1

PDB Entry: 2ae9

PDB Description: solution structure of the theta subunit of dna polymerase iii from e. coli

PDB Compounds: (A:) DNA polymerase III, theta subunit

SCOPe Domain Sequences for d2ae9a1:

Sequence; same for both SEQRES and ATOM records:

>d2ae9a1 a.237.1.1 (A:1-76) Theta subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
lasvnlsrlpyepklk

Timeline for d2ae9a1:

• d2ae9a1 first appeared in SCOP 1.73
  
• d2ae9a1 appears in SCOPe 2.02
  
• d2ae9a1 is called d2ae9a_ in SCOPe 2.04
  
• d2ae9a1 appears in the current release, SCOPe 2.08, called d2ae9a_