Lineage for d2ae9a1 (2ae9 A:1-76)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1102347Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
    3 helices; irregular array
  4. 1102348Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) (S)
  5. 1102349Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
    Pfam PF06440
    independent solution structure determinations of different members resulted in similar secondary structures but different folds
  6. 1102355Protein Theta subunit of DNA polymerase III [46577] (1 species)
  7. 1102356Species Escherichia coli [TaxId:562] [46578] (3 PDB entries)
  8. 1102357Domain d2ae9a1: 2ae9 A:1-76 [126616]
    automatically matched to d1du2a_

Details for d2ae9a1

PDB Entry: 2ae9 (more details)

PDB Description: solution structure of the theta subunit of dna polymerase iii from e. coli
PDB Compounds: (A:) DNA polymerase III, theta subunit

SCOPe Domain Sequences for d2ae9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ae9a1 a.237.1.1 (A:1-76) Theta subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
lasvnlsrlpyepklk

SCOPe Domain Coordinates for d2ae9a1:

Click to download the PDB-style file with coordinates for d2ae9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ae9a1: