Lineage for d2ae8b1 (2ae8 B:1-84)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930730Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
    duplication; there are two structural repeats of this fold
  6. 2930731Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)
  7. 2930737Species Staphylococcus aureus [TaxId:1280] [142927] (1 PDB entry)
    Uniprot P64373 1-84! Uniprot P64373 85-179
  8. 2930740Domain d2ae8b1: 2ae8 B:1-84 [126606]
    Other proteins in same PDB: d2ae8b3, d2ae8e3
    automated match to d2ae8a1
    complexed with mg

Details for d2ae8b1

PDB Entry: 2ae8 (more details), 2.01 Å

PDB Description: crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315
PDB Compounds: (B:) Imidazoleglycerol-phosphate dehydratase

SCOPe Domain Sequences for d2ae8b1:

Sequence, based on SEQRES records: (download)

>d2ae8b1 d.14.1.9 (B:1-84) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]}
miyqkqrntaetqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgdidvd
dhhvtedigivigqlllemikdkk

Sequence, based on observed residues (ATOM records): (download)

>d2ae8b1 d.14.1.9 (B:1-84) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]}
miyqkqrnqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgddhhvtedi
givigqlllemikdkk

SCOPe Domain Coordinates for d2ae8b1:

Click to download the PDB-style file with coordinates for d2ae8b1.
(The format of our PDB-style files is described here.)

Timeline for d2ae8b1: