![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein automated matches [190241] (13 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:226185] [187396] (1 PDB entry) |
![]() | Domain d2ae6d_: 2ae6 D: [126603] Other proteins in same PDB: d2ae6a1 automated match to d2ae6a1 complexed with eoh, gol, mg |
PDB Entry: 2ae6 (more details), 2.19 Å
SCOPe Domain Sequences for d2ae6d_:
Sequence, based on SEQRES records: (download)
>d2ae6d_ d.108.1.1 (D:) automated matches {Enterococcus faecalis [TaxId: 226185]} ltirlvaeadwpalhaldqiiwtkkntpaeiqplslaayqekmkdetifvaisgqqlagf ievhpptslaahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvmatnq eairfyekhgfvqeahfkeefyinghycddyqyayfi
>d2ae6d_ d.108.1.1 (D:) automated matches {Enterococcus faecalis [TaxId: 226185]} ltirlvaeadwpalhaldqiislaayqekmkdetifvaisgqqlagfievhpptslaahq kqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvmatnqeairfyekhgfvq eahfkeefyinghycddyqyayfi
Timeline for d2ae6d_: