Lineage for d2ae6c_ (2ae6 C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. Protein automated matches [190241] (13 species)
    not a true protein
  7. Species Enterococcus faecalis [TaxId:226185] [187396] (1 PDB entry)
  8. Domain d2ae6c_: 2ae6 C: [126602]
    Other proteins in same PDB: d2ae6a1
    automated match to d2ae6a1
    complexed with eoh, gol, mg

Details for d2ae6c_

PDB Entry: 2ae6 (more details), 2.19 Å

PDB Description: Crystal Structure of Acetyltransferase of GNAT family from Enterococcus faecalis V583
PDB Compounds: (C:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d2ae6c_:

Sequence, based on SEQRES records: (download)

>d2ae6c_ d.108.1.1 (C:) automated matches {Enterococcus faecalis [TaxId: 226185]}
sltirlvaeadwpalhaldqiiwtkkntpaeiqplslaayqekmkdetifvaisgqqlag
fievhpptslaahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvmatn
qeairfyekhgfvqeahfkeefyinghycddyqyayfi

Sequence, based on observed residues (ATOM records): (download)

>d2ae6c_ d.108.1.1 (C:) automated matches {Enterococcus faecalis [TaxId: 226185]}
sltirlvaeadwpalhaldqiislaayqekmkdetifvaisgqqlagfievhpptslaah
qkqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvmatnqeairfyekhgfv
qeahfkeefyinghycddyqyayfi

SCOPe Domain Coordinates for d2ae6c_ are not available.

Timeline for d2ae6c_:

Domains from other chains:
(mouse over for more information)
d2ae6a1, d2ae6b_, d2ae6d_