Lineage for d2ae6b_ (2ae6 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209547Protein automated matches [190241] (12 species)
    not a true protein
  7. 2209562Species Enterococcus faecalis [TaxId:226185] [187396] (1 PDB entry)
  8. 2209563Domain d2ae6b_: 2ae6 B: [126601]
    Other proteins in same PDB: d2ae6a1
    automated match to d2ae6a1
    complexed with eoh, gol, mg

Details for d2ae6b_

PDB Entry: 2ae6 (more details), 2.19 Å

PDB Description: Crystal Structure of Acetyltransferase of GNAT family from Enterococcus faecalis V583
PDB Compounds: (B:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d2ae6b_:

Sequence, based on SEQRES records: (download)

>d2ae6b_ d.108.1.1 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
mstsltirlvaeadwpalhaldqiiwtkkntpaeiqplslaayqekmkdetifvaisgqq
lagfievhpptslaahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvm
atnqeairfyekhgfvqeahfkeefyinghycddyqyayfi

Sequence, based on observed residues (ATOM records): (download)

>d2ae6b_ d.108.1.1 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
mstsltirlvaeadwpalhaldqiilaayqekmkdetifvaisgqqlagfievhpptsla
ahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvmatnqeairfyekhg
fvqeahfkeefyinghycddyqyayfi

SCOPe Domain Coordinates for d2ae6b_:

Click to download the PDB-style file with coordinates for d2ae6b_.
(The format of our PDB-style files is described here.)

Timeline for d2ae6b_: