Lineage for d2ae6b1 (2ae6 B:1-161)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731263Protein Putative acetyltransferase EF0244 [143664] (1 species)
  7. 731264Species Enterococcus faecalis [TaxId:1351] [143665] (1 PDB entry)
  8. 731266Domain d2ae6b1: 2ae6 B:1-161 [126601]
    automatically matched to 2AE6 A:1-161
    complexed with eoh, gol, mg

Details for d2ae6b1

PDB Entry: 2ae6 (more details), 2.19 Å

PDB Description: Crystal Structure of Acetyltransferase of GNAT family from Enterococcus faecalis V583
PDB Compounds: (B:) acetyltransferase, GNAT family

SCOP Domain Sequences for d2ae6b1:

Sequence, based on SEQRES records: (download)

>d2ae6b1 d.108.1.1 (B:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]}
mstsltirlvaeadwpalhaldqiiwtkkntpaeiqplslaayqekmkdetifvaisgqq
lagfievhpptslaahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvm
atnqeairfyekhgfvqeahfkeefyinghycddyqyayfi

Sequence, based on observed residues (ATOM records): (download)

>d2ae6b1 d.108.1.1 (B:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]}
mstsltirlvaeadwpalhaldqiilaayqekmkdetifvaisgqqlagfievhpptsla
ahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvmatnqeairfyekhg
fvqeahfkeefyinghycddyqyayfi

SCOP Domain Coordinates for d2ae6b1:

Click to download the PDB-style file with coordinates for d2ae6b1.
(The format of our PDB-style files is described here.)

Timeline for d2ae6b1: