Lineage for d2ae6a1 (2ae6 A:1-161)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533487Protein Putative acetyltransferase EF0244 [143664] (1 species)
  7. 2533488Species Enterococcus faecalis [TaxId:1351] [143665] (1 PDB entry)
    Uniprot Q839D1 1-161
  8. 2533489Domain d2ae6a1: 2ae6 A:1-161 [126600]
    Other proteins in same PDB: d2ae6b_, d2ae6c_, d2ae6d_
    complexed with eoh, gol, mg

Details for d2ae6a1

PDB Entry: 2ae6 (more details), 2.19 Å

PDB Description: Crystal Structure of Acetyltransferase of GNAT family from Enterococcus faecalis V583
PDB Compounds: (A:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d2ae6a1:

Sequence, based on SEQRES records: (download)

>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]}
mstsltirlvaeadwpalhaldqiiwtkkntpaeiqplslaayqekmkdetifvaisgqq
lagfievhpptslaahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvm
atnqeairfyekhgfvqeahfkeefyinghycddyqyayfi

Sequence, based on observed residues (ATOM records): (download)

>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]}
mstsltirlvaeadwpalhaldqiislaayqekmkdetifvaisgqqlagfievhpptsl
aahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvmatnqeairfyekh
gfvqeahfkeefyinghycddyqyayfi

SCOPe Domain Coordinates for d2ae6a1:

Click to download the PDB-style file with coordinates for d2ae6a1.
(The format of our PDB-style files is described here.)

Timeline for d2ae6a1: