![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein Alpha-1-syntrophin [141411] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [141412] (1 PDB entry) Uniprot Q61234 2-44,203-264 |
![]() | Domain d2adza1: 2adz A:1-43,A:117-178 [126599] split PH domain; excluded region 44-116 contains disordered bits of truncated PDZ domain-containing insert region |
PDB Entry: 2adz (more details)
SCOPe Domain Sequences for d2adza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} asgrraprtgllelrcgagsgaggerwqrvllslaedaltvspXlseakhvslkmayvsr rctptdpepryleicaadgqdavflrakdeasarswagaiqaqigt
Timeline for d2adza1: