Lineage for d2adza1 (2adz A:1-43,A:117-178)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803076Protein Alpha-1-syntrophin [141411] (1 species)
  7. 2803077Species Mouse (Mus musculus) [TaxId:10090] [141412] (1 PDB entry)
    Uniprot Q61234 2-44,203-264
  8. 2803078Domain d2adza1: 2adz A:1-43,A:117-178 [126599]
    split PH domain; excluded region 44-116 contains disordered bits of truncated PDZ domain-containing insert region

Details for d2adza1

PDB Entry: 2adz (more details)

PDB Description: solution structure of the joined ph domain of alpha1-syntrophin
PDB Compounds: (A:) Alpha-1-syntrophin

SCOPe Domain Sequences for d2adza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]}
asgrraprtgllelrcgagsgaggerwqrvllslaedaltvspXlseakhvslkmayvsr
rctptdpepryleicaadgqdavflrakdeasarswagaiqaqigt

SCOPe Domain Coordinates for d2adza1:

Click to download the PDB-style file with coordinates for d2adza1.
(The format of our PDB-style files is described here.)

Timeline for d2adza1: