SCOP 1.73: Domain d2adua1: 2adu A:375-448

Lineage for d2adua1 (2adu A:375-448)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
   circularly permuted version of the "winged helix" fold

6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46890] (16 PDB entries)

8. Domain d2adua1: 2adu A:375-448 [126595]
   Other proteins in same PDB: d2adua2
   automatically matched to d1b59a1
   complexed with co, r20; mutant

Details for d2adua1

PDB Entry: 2adu, 1.9 Å

PDB Description: human methionine aminopeptidase complex with 4-aryl-1,2,3-triazole inhibitor

PDB Compounds: (A:) Methionine aminopeptidase 2

SCOP Domain Sequences for d2adua1:

Sequence; same for both SEQRES and ATOM records:

>d2adua1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens) [TaxId: 9606]}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

Timeline for d2adua1:

• d2adua1 is new in SCOP 1.73
  
• d2adua1 appears in SCOP 1.75
  
• d2adua1 appears in the current release, SCOPe 2.08