![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries) |
![]() | Domain d2adpa2: 2adp A:84-196 [126592] Other proteins in same PDB: d2adpa1 automated match to d1luva2 complexed with k, mn |
PDB Entry: 2adp (more details), 2.4 Å
SCOPe Domain Sequences for d2adpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2adpa2 d.44.1.1 (A:84-196) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymac
Timeline for d2adpa2: