Lineage for d2adpa2 (2adp A:84-196)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) 
automatically mapped to Pfam PF02777Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) 
Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries) 
Domain d2adpa2: 2adp A:84-196 [126592]
Other proteins in same PDB: d2adpa1
automated match to d1luva2
complexed with k, mn
Details for d2adpa2
PDB Entry: 2adp (more details), 2.4 Å
PDB Description: Nitrated Human Manganese Superoxide Dismutase
PDB Compounds: (A:) Superoxide dismutase [Mn]SCOPe Domain Sequences for d2adpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2adpa2 d.44.1.1 (A:84-196) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymac
SCOPe Domain Coordinates for d2adpa2:
Click to download the PDB-style file with coordinates for d2adpa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2adpa2:
- d2adpa2 first appeared in SCOP 1.73
- d2adpa2 appears in SCOPe 2.07
View in 3D
