Lineage for d2adjb1 (2adj B:114-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655656Domain d2adjb1: 2adj B:114-213 [126590]
    automatically matched to d1fnsh2
    complexed with ca

Details for d2adjb1

PDB Entry: 2adj (more details), 2.9 Å

PDB Description: Crystal structure of monoclonal anti-CD4 antibody Q425 in complex with Calcium
PDB Compounds: (B:) Q425 Fab Heavy chain

SCOP Domain Sequences for d2adjb1:

Sequence, based on SEQRES records: (download)

>d2adjb1 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d2adjb1 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d2adjb1:

Click to download the PDB-style file with coordinates for d2adjb1.
(The format of our PDB-style files is described here.)

Timeline for d2adjb1: