Lineage for d2adib_ (2adi B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745259Domain d2adib_: 2adi B: [126589]
    Other proteins in same PDB: d2adia1, d2adia2
    automated match to d6shgh_
    complexed with ba, trs

Details for d2adib_

PDB Entry: 2adi (more details), 2.8 Å

PDB Description: crystal structure of monoclonal anti-cd4 antibody q425 in complex with barium
PDB Compounds: (B:) Q425 Fab Heavy chain

SCOPe Domain Sequences for d2adib_:

Sequence, based on SEQRES records: (download)

>d2adib_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvesggdlvkpggslklscaasgftfssygmswvrqtpdkglewvatissggsytyy
pdnvkgrftisrdnakntlylqmsslksedtamyycarhedgnwnyfdywgqgttltvss
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d2adib_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvesggdlvkpggslklscaasgftfssygmswvrqtpdkglewvatissggsytyy
pdnvkgrftisrdnakntlylqmsslksedtamyycarhedgnwnyfdywgqgttltvss
akttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d2adib_:

Click to download the PDB-style file with coordinates for d2adib_.
(The format of our PDB-style files is described here.)

Timeline for d2adib_: