SCOPe 2.08: Domain d2adfl2: 2adf L:107-209

Lineage for d2adfl2 (2adf L:107-209)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d2adfl2: 2adf L:107-209 [126587]
   Other proteins in same PDB: d2adfa_, d2adfh_, d2adfl1
   automated match to d1eapa2
   complexed with acy, gol, so4

Details for d2adfl2

PDB Entry: 2adf, 1.9 Å

PDB Description: Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody Directed Against the von Willebrand factor A3-Domain

PDB Compounds: (L:) 82D6A3 IgG

SCOPe Domain Sequences for d2adfl2:

Sequence; same for both SEQRES and ATOM records:

>d2adfl2 b.1.1.2 (L:107-209) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Timeline for d2adfl2:

• d2adfl2 first appeared in SCOP 1.73
  
• d2adfl2 appears in SCOPe 2.07