SCOP 1.73: Domain d2adfh1: 2adf H:119-218

Lineage for d2adfh1 (2adf H:119-218)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d2adfh1: 2adf H:119-218 [126585]
   Other proteins in same PDB: d2adfa1, d2adfl1, d2adfl2
   automatically matched to d1mj8h2
   complexed with acy, gol, so4

Details for d2adfh1

PDB Entry: 2adf, 1.9 Å

PDB Description: Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody Directed Against the von Willebrand factor A3-Domain

PDB Compounds: (H:) 82D6A3 IgG

SCOP Domain Sequences for d2adfh1:

Sequence; same for both SEQRES and ATOM records:

>d2adfh1 b.1.1.2 (H:119-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d2adfh1:

• d2adfh1 is new in SCOP 1.73
  
• d2adfh1 appears in SCOP 1.75
  
• d2adfh1 appears in the current release, SCOPe 2.08, called d2adfh_