Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
Domain d2adfh1: 2adf H:119-218 [126585] Other proteins in same PDB: d2adfa1, d2adfl1, d2adfl2 automatically matched to d1mj8h2 complexed with acy, gol, so4 |
PDB Entry: 2adf (more details), 1.9 Å
SCOP Domain Sequences for d2adfh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2adfh1 b.1.1.2 (H:119-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d2adfh1: