Lineage for d2adfh_ (2adf H:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. Domain d2adfh_: 2adf H: [126585]
    Other proteins in same PDB: d2adfa_, d2adfl1, d2adfl2
    automated match to d6shgh_
    complexed with acy, gol, so4

Details for d2adfh_

PDB Entry: 2adf (more details), 1.9 Å

PDB Description: Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody Directed Against the von Willebrand factor A3-Domain
PDB Compounds: (H:) 82D6A3 IgG

SCOPe Domain Sequences for d2adfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2adfh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgytfinygmnwvkqapgkglkwmgwkntntgetty
geefrgrfafsletsvstaylqinnlknedtatyfcardnpyyaldywgqgttvtvssak
ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d2adfh_ are not available.

Timeline for d2adfh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2adfa_, d2adfl1, d2adfl2