Lineage for d2adfa1 (2adf A:922-1110)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839328Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 839329Superfamily c.62.1: vWA-like [53300] (5 families) (S)
  5. 839330Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 839437Protein von Willebrand factor A3 domain, vWA3 [53304] (1 species)
  7. 839438Species Human (Homo sapiens) [TaxId:9606] [53305] (4 PDB entries)
  8. 839441Domain d2adfa1: 2adf A:922-1110 [126584]
    Other proteins in same PDB: d2adfh1, d2adfl1, d2adfl2
    automatically matched to d1fe8c_
    complexed with acy, gol, so4

Details for d2adfa1

PDB Entry: 2adf (more details), 1.9 Å

PDB Description: Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody Directed Against the von Willebrand factor A3-Domain
PDB Compounds: (A:) von willebrand factor

SCOP Domain Sequences for d2adfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2adfa1 c.62.1.1 (A:922-1110) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]}
dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp
wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs
vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg
nsflhklcs

SCOP Domain Coordinates for d2adfa1:

Click to download the PDB-style file with coordinates for d2adfa1.
(The format of our PDB-style files is described here.)

Timeline for d2adfa1: