SCOP 1.73: Domain d2adfa1: 2adf A:922-1110

Lineage for d2adfa1 (2adf A:922-1110)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (5 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)

6. Protein von Willebrand factor A3 domain, vWA3 [53304] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53305] (4 PDB entries)

8. Domain d2adfa1: 2adf A:922-1110 [126584]
   Other proteins in same PDB: d2adfh1, d2adfl1, d2adfl2
   automatically matched to d1fe8c_
   complexed with acy, gol, so4

Details for d2adfa1

PDB Entry: 2adf, 1.9 Å

PDB Description: Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody Directed Against the von Willebrand factor A3-Domain

PDB Compounds: (A:) von willebrand factor

SCOP Domain Sequences for d2adfa1:

Sequence; same for both SEQRES and ATOM records:

>d2adfa1 c.62.1.1 (A:922-1110) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]}
dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp
wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs
vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg
nsflhklcs

Timeline for d2adfa1:

• d2adfa1 is new in SCOP 1.73
  
• d2adfa1 appears in SCOP 1.75
  
• d2adfa1 appears in the current release, SCOPe 2.08, called d2adfa_