Lineage for d2adba1 (2adb A:172-284)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952068Protein Polypyrimidine tract-binding protein [54950] (1 species)
  7. 2952069Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries)
    Uniprot P26599 54-141, 177-284, 335-531
  8. 2952076Domain d2adba1: 2adb A:172-284 [126581]
    automatically matched to d1sjra_
    protein/RNA complex

Details for d2adba1

PDB Entry: 2adb (more details)

PDB Description: solution structure of polypyrimidine tract binding protein rbd2 complexed with cucucu rna
PDB Compounds: (A:) Polypyrimidine tract-binding protein 1

SCOPe Domain Sequences for d2adba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2adba1 d.58.7.1 (A:172-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}
dagmamagqspvlriivenlfypvtldvlhqifskfgtvlkiitftknnqfqallqyadp
vsaqhaklsldgqniynacctlridfskltslnvkynndksrdytrpdlpsgd

SCOPe Domain Coordinates for d2adba1:

Click to download the PDB-style file with coordinates for d2adba1.
(The format of our PDB-style files is described here.)

Timeline for d2adba1: