Lineage for d2ad9a1 (2ad9 A:49-146)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2558933Protein Polypyrimidine tract-binding protein [54950] (1 species)
  7. 2558934Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries)
    Uniprot P26599 54-141, 177-284, 335-531
  8. 2558937Domain d2ad9a1: 2ad9 A:49-146 [126580]
    protein/RNA complex

Details for d2ad9a1

PDB Entry: 2ad9 (more details)

PDB Description: solution structure of polypyrimidine tract binding protein rbd1 complexed with cucucu rna
PDB Compounds: (A:) Polypyrimidine tract-binding protein 1

SCOPe Domain Sequences for d2ad9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ad9a1 d.58.7.1 (A:49-146) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}
gdsrsagvpsrvihirklpidvtegevislglpfgkvtnllmlkgknqafiemnteeaan
tmvnyytsvtpvlrgqpiyiqfsnhkelktdsspnqar

SCOPe Domain Coordinates for d2ad9a1:

Click to download the PDB-style file with coordinates for d2ad9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ad9a1: