![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
![]() | Protein Polypyrimidine tract-binding protein [54950] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries) |
![]() | Domain d2ad9a1: 2ad9 A:49-146 [126580] |
PDB Entry: 2ad9 (more details)
SCOP Domain Sequences for d2ad9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ad9a1 d.58.7.1 (A:49-146) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} gdsrsagvpsrvihirklpidvtegevislglpfgkvtnllmlkgknqafiemnteeaan tmvnyytsvtpvlrgqpiyiqfsnhkelktdsspnqar
Timeline for d2ad9a1: