Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein Polypyrimidine tract-binding protein [54950] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries) Uniprot P26599 54-141, 177-284, 335-531 |
Domain d2ad9a1: 2ad9 A:49-146 [126580] protein/RNA complex |
PDB Entry: 2ad9 (more details)
SCOPe Domain Sequences for d2ad9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ad9a1 d.58.7.1 (A:49-146) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} gdsrsagvpsrvihirklpidvtegevislglpfgkvtnllmlkgknqafiemnteeaan tmvnyytsvtpvlrgqpiyiqfsnhkelktdsspnqar
Timeline for d2ad9a1: