Lineage for d2ad8d_ (2ad8 D:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. Protein Methanol dehydrogenase, light chain [48668] (3 species)
  7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (6 PDB entries)
  8. Domain d2ad8d_: 2ad8 D: [126579]
    Other proteins in same PDB: d2ad8a_, d2ad8c_
    automated match to d4aahb_
    complexed with ca, pqq

Details for d2ad8d_

PDB Entry: 2ad8 (more details), 1.6 Å

PDB Description: crystal structure of methanol dehydrogenase from M. W3A1 (form C) in the presence of ethanol
PDB Compounds: (D:) methanol dehydrogenase subunit 2

SCOPe Domain Sequences for d2ad8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ad8d_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
sgnfvfdvk

SCOPe Domain Coordinates for d2ad8d_ are not available.

Timeline for d2ad8d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ad8a_, d2ad8b_, d2ad8c_