Lineage for d2ad7c1 (2ad7 C:1-571)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675578Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 675579Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (1 family) (S)
  5. 675580Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (3 proteins)
  6. 675585Protein Methanol dehydrogenase, heavy chain [51000] (3 species)
  7. 675595Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51001] (5 PDB entries)
  8. 675599Domain d2ad7c1: 2ad7 C:1-571 [126574]
    Other proteins in same PDB: d2ad7b1, d2ad7d1
    automatically matched to d1g72a_
    complexed with ca, pqq

Details for d2ad7c1

PDB Entry: 2ad7 (more details), 1.5 Å

PDB Description: crystal structure of methanol dehydrogenase from M. W3A1 (form C) in the presence of methanol
PDB Compounds: (C:) methanol dehydrogenase subunit 1

SCOP Domain Sequences for d2ad7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ad7c1 b.70.1.1 (C:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
tdpsaglgavgafrelqnhtqmggglmvfsl

SCOP Domain Coordinates for d2ad7c1:

Click to download the PDB-style file with coordinates for d2ad7c1.
(The format of our PDB-style files is described here.)

Timeline for d2ad7c1: